PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00034786001
Common NameGSBRNA2T00034786001, LOC106431642
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 236aa    MW: 25964.2 Da    PI: 10.295
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00034786001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.83.2e-32126181258
            CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  GSBRNA2T00034786001 126 EPMFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 181
                          9****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.4E-36123184IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.14124184IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.2E-27126181IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.7E-23127149IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860129149IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.7E-23158181IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MQVPTHSNIQ GSQSFSLTKN LMMPCSMKHS GLQLQDQDSS STQSTEESGG GYIVSPAGKA  60
IASYTKSATT SSMVSHDSVF PPPPPTYFNG FLAPEYASQP TVLPHVEMMG LFTSRVPLPH  120
NYQESEPMFV NAKQYHAILR RRKHRAKLEA QNKLIKSRKP YLHESRHLHA LKRARGSGGR  180
FLNTKKLQES SSNSLCSSSV TPSSSSDRDN MFQNPTFRFS GYPSTHHVSA LMSGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-21125186263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.190482e-66seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00034786001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869571e-113AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
GenBankAY0814451e-113AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590436.11e-174PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_013727900.11e-174PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
SwissprotQ9SYH41e-113NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078GNE11e-174A0A078GNE1_BRANA; BnaC06g10580D protein
TrEMBLA0A0D3CSB31e-174A0A0D3CSB3_BRAOL; Uncharacterized protein
STRINGBra014368.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.17e-92nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]